PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009589282.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 193aa    MW: 21874.1 Da    PI: 8.597
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009589282.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK39.31.3e-123070444
          RWP-RK  4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRW 44
                    +isl dl+++F ++ +dAA +Lgv++++ Kr CR +G++ W
  XP_009589282.1 30 RISLGDLQQQFGKKRNDAAESLGVSPSTFKRCCRANGLAKW 70
                    699************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS515199.94313101IPR003035RWP-RK domain
PfamPF020421.6E-123170IPR003035RWP-RK domain
SuperFamilySSF542771.57E-1590179No hitNo description
Gene3DG3DSA:3.10.20.2405.1E-1497179No hitNo description
PfamPF005642.3E-13100180IPR000270PB1 domain
SMARTSM006668.1E-12100182IPR000270PB1 domain
PROSITE profilePS5174514.35100177IPR000270PB1 domain
CDDcd059922.14E-16103179No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MQIVHVNETT VLHQNYLRPR GKSKEKDYCR ISLGDLQQQF GKKRNDAAES LGVSPSTFKR  60
CCRANGLAKW SCKLKVQPHT TPTLTQRVVE SMATFQSDNT MSLKVSYNGV NVRFPLILSS  120
GKNDLEAEVE TRFGIQIGSF SIMYEDEDKD WILITCDLDL HHGMHILKNK GITTMKINLV  180
NQIECDRIPN SNA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589282.11e-145PREDICTED: protein NLP3-like
RefseqXP_016494410.11e-142PREDICTED: protein NLP5-like isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1819734
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.13e-11Nin-like family protein